Learn More
Abnova™ Human MGAT1 Partial ORF (NP_002397, 348 a.a. - 445 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
Numero di accesso | NP_002397 |
---|---|
Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID gene (immissione) | 4245 |
Peso molecolare | 36.52kDa |
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
---|---|---|---|---|---|---|---|---|---|
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
16151215
|
Abnova™
H00004245-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
16161215
|
Abnova™
H00004245-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene. [provided by RefSeq]
Sequence: YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWNSpecifica
NP_002397 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.52kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GLCNAC-TI/GLCT1/GLYT1/GNT-1/GNT-I/MGAT | |
MGAT1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
4245 | |
MGAT1 (Human) Recombinant Protein (Q01) | |
YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWN | |
RUO | |
MGAT1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |