missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDST4 Partial ORF (NP_072091, 122 a.a. - 214 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00064579-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16129676

  • 335.00€ / 10µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

Sequence: DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP
Specifica

Specifica

NP_072091
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP
RUO
NDST4
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
64579
NDST4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDST4
Wheat Germ (in vitro)
GST
Liquid
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali