missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PLN Partial ORF (AAH05269, 1 a.a. - 30 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005350-Q01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq]
Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNSpecifica
| AAH05269 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 28.93kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MEKVQYLTRSAIRRASTIEMPQQARQKLQN | |
| RUO | |
| PLN | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5350 | |
| PLN (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CMD1P/PLB | |
| PLN | |
| Recombinant | |
| wheat germ expression system |