missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POLR2K Full-length ORF (NP_005025.1, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005440-P02.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16163055

  • 302.00€ / 10µg


Spedizione stimata
23-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Specifica

Specifica

NP_005025.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABC10-alpha|RPABC4|RPB10alpha|RPB12|RPB7.0|hRPB7.0|hsRPB10a
POLR2K
Yes
wheat germ expression system
Liquid
5440
POLR2K (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
RUO
POLR2K
Wheat Germ (in vitro)
GST
Videos
Documenti