missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPP2R2B Partial ORF (AAH31790, 101 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005521-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16159451

  • 458.00€ / 25µg


Spedizione stimata
18-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: QNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWN
Specifica

Specifica

AAH31790
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWN
RUO
PPP2R2B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5521
PPP2R2B (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B55-BETA|FLJ95686|MGC24888|PP2A-B55BETA|PP2A-PR55B|PP2AB-BETA|PP2APR55-BETA|PR2AB-BETA|PR2AB55-BETA|PR2APR55-BETA|PR52B|PR55-BETA|SCA12
PPP2R2B
Yes
Videos
Documentos