missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPP2R5C Partial ORF (NP_002710.2, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005527-Q01.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16014555

  • 320.54€ / 10µg


Spedizione stimata
31-05-2021
Aggiungi al carrello

Descrizione

Descrizione

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Specifica

Specifica

NP_002710.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
RUO
PPP2R5C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5527
PPP2R5C (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B56G|MGC23064|PR61G
PPP2R5C
Yes
Videos
SDS
Documenti