missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRH2 Full-length ORF (NP_005033.1, 1 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005555-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16159511

  • 302.00€ / 10µg


Spedizione stimata
01-12-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
Specifica

Specifica

NP_005033.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686B01256|DKFZp686F14256|DKFZp686I11251|DKFZp686J06255|DKFZp686L01253|DKFZp686L16244|DKFZp686M04243|DKFZp686N24248|Pr
PRH2
Yes
wheat germ expression system
Liquid
5555
PRH2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
RUO
PRH2
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti