missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRKG1 Partial ORF (NP_006249, 73 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005592-Q01.25ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16064575

  • 458.00€ / 25µg


Spedizione stimata
29-10-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Specifica

Specifica

NP_006249
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
RUO
PRKG1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5592
PRKG1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
PRKG1
Yes
Videos
Documenti