missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMAD6 Partial ORF (NP_005576, 285 a.a. - 384 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004091-Q01.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16014365

  • 320.54€ / 10µg


Spedizione stimata
07-06-2021
Aggiungi al carrello

Descrizione

Descrizione

The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Specifica

Specifica

NP_005576
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
RUO
SMAD6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4091
SMAD6 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HsT17432|MADH6|MADH7
SMAD6
Yes
Videos
SDS
Documenti