missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SOX2 Partial ORF (NP_003097, 155 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifica

Numero di accesso NP_003097
Da utilizzare con (applicazione) Antibody Production, ELISA, Protein Array, Western Blot
Formulazione 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID gene (immissione) 6657
Peso molecolare 35.75kDa
Visualizza altre specifiche

Prodotti 2
Codice del prodotto Marca Quantità Prezzo Quantità e disponibilità  
Codice del prodotto Marca Quantità Prezzo Quantità e disponibilità  
16135685
Vedere i documenti Dettagli della promozione
Abnova™
H00006657-Q01.25UG
25 ug
508.00€
25µg
Visualizzare prodotti alternativi
Risparmia fino a 
»
Spedizione stimata: 21-08-2024
per visualizzare lo stock disponibile
Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!
16125685
Vedere i documenti Dettagli della promozione
Abnova™
H00006657-Q01.10UG
10 ug
335.00€
10µg
Visualizzare prodotti alternativi
Risparmia fino a 
»
Spedizione stimata: 21-08-2024
per visualizzare lo stock disponibile
Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!
Descrizione

Descrizione

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq]

Sequence: QRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVK
Specifica

Specifica

NP_003097
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ANOP3/MCOPS3/MGC2413
SOX2
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
6657
SOX2 (Human) Recombinant Protein (Q01)
QRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVK
RUO
SOX2
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documenti

Documenti

Product Certifications