missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TNFSF12 Partial ORF (AAH19047, 49 a.a. - 134 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008742-Q01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Some transcripts that skip the last exon of this gene and continue with the second exon of the neighboring TNFSF13 gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq]
Sequence: SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRPSpecifica
| AAH19047 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.2kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP | |
| RUO | |
| TNFSF12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8742 | |
| TNFSF12 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| APO3L/DR3LG/MGC129581/MGC20669/TWEAK | |
| TNFSF12 | |
| Recombinant | |
| wheat germ expression system |