missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIP11 Partial ORF (NP_004230.1, 1756 a.a. - 1855 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009321-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160366

  • 458.00€ / 25µg


Spedizione stimata
24-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
Specifica

Specifica

NP_004230.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
RUO
TRIP11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9321
TRIP11 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CEV14|GMAP-210|TRIP230
TRIP11
Yes
Videos
Documenti