missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TUBGCP5 Partial ORF (NP_443135.2, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00114791-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161417

  • 302.00€ / 10µg


Spedizione stimata
24-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI
Specifica

Specifica

NP_443135.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI
RUO
TUBGCP5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
114791
TUBGCP5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GCP5|KIAA1899
TUBGCP5
Yes
Videos
Documenti