missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human VAPB Partial ORF (NP_004729.1, 124 a.a. - 223 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
Numero di accesso | NP_004729.1 |
---|---|
Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID gene (immissione) | 9217 |
Peso molecolare | 36.74kDa |
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
---|---|---|---|---|---|---|---|---|---|
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
16160176
|
Abnova™
H00009217-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 05-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
16150176
|
Abnova™
H00009217-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 05-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq]
Sequence: ELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRSpecifica
NP_004729.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ALS8/VAMP-B/VAMP-C/VAP-B/VAP-C | |
VAPB | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9217 | |
VAPB (Human) Recombinant Protein (Q01) | |
ELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTR | |
RUO | |
VAPB | |
Wheat Germ (in vitro) | |
GST | |
Liquid |