missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human VEGFA Full-length ORF (ENSP00000361134, 1 a.a. - 147 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00007422-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161822

  • 302.00€ / 10µg


Spedizione stimata
27-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Specifica

Specifica

ENSP00000361134
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC70609|VEGF|VEGF-A|VPF
VEGFA
Yes
wheat germ expression system
Liquid
7422
VEGFA (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
RUO
VEGFA
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti