missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human VIL1 Partial ORF (NP_009058, 1 a.a. - 77 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007429-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. [provided by RefSeq]
Sequence: MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGASpecifica
| NP_009058 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.21kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA | |
| RUO | |
| VIL1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 7429 | |
| VIL1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| D2S1471/VIL | |
| VIL1 | |
| Recombinant | |
| wheat germ expression system |