missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human WNK4 Partial ORF (NP_115763.2, 1144 a.a. - 1243 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | NP_115763.2 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 65266 |
| Peso molecolare | 36.74kDa |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16169826
|
Abnova™
H00065266-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16159826
|
Abnova™
H00065266-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 30-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
This gene encodes a member of the WNK family of serine-threonine protein kinases. The kinase is part of the tight junction complex in kidney cells, and regulates the balance between NaCl reabsorption and K(+) secretion. The kinase regulates the activities of several types of ion channels, cotransporters, and exchangers involved in electrolyte flux in epithelial cells. Mutations in this gene result in pseudohypoaldosteronism type IIB
Sequence: KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRMSpecifica
| NP_115763.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PHA2B/PRKWNK4 | |
| WNK4 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 65266 | |
| WNK4 (Human) Recombinant Protein (Q01) | |
| KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM | |
| RUO | |
| WNK4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |