missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZFP36L1 Partial ORF (NP_004917, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00000677-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162341

  • 458.00€ / 25µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Specifica

Specifica

NP_004917
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
RUO
ZFP36L1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
677
ZFP36L1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BRF1|Berg36|ERF-1|ERF1|RNF162B|TIS11B|cMG1
ZFP36L1
Yes
Videos
Documenti