missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ KIAA0753/MNR Recombinant Protein Antigen

Codice prodotto. 18268948 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
Dimensione della confezione:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18268948 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18268948 Fornitore Novus Biologicals™ N. del fornitore NBP190931PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA0753. The KIAA0753/MNR Recombinant Protein Antigen is derived from E. coli. The KIAA0753/MNR Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-90931. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 9851
Specie Human
Metodo di purificazione Chromatography
Purezza >80%
Concentrazione 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Simbolo del gene KIAA0753
Tipo di etichetta Unlabeled
Peso molecolare 30kDa
Product Type KIAA0753
Quantità 0.1 mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90931. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno PCNGNSLDESVGTEEGSEKREAPLLSLAEDSQQKEGRAPLFVPPGMQHSIGDYCSRFEQYLRIISHEAVGSFNPWLIAESFSEELVDEALGAVAAELQDMCEDYAEAVFTSE
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.