missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ KLRC4 Recombinant Protein
335.00€ - 508.00€
Specifica
| Numero di accesso | AAH17784 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID gene (immissione) | 8302 |
| Peso molecolare | 43.12 |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16162352
|
Abnova™
H00008302-P01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 31-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16172352
|
Abnova™
H00008302-P01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 31-05-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
| AAH17784 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 43.12 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KLRC4 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 8302 | |
| KLRC4 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL | |
| FLJ17759/FLJ78582/NKG2-F/NKG2F | |
| KLRC4 | |
| Wheat Germ (in vitro) | |
| GST |