missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Laminin beta 1 Antibody (CL2970), Novus Biologicals™

Laminin beta 1 Antibody (CL2970), Novus Biologicals™

Codice prodotto. 18603289 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18603289 0.1 mL 0.10mL
18655937 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18603289 Fornitore Novus Biologicals N. del fornitore NBP242385
 Articolo soggetto a restrizioni
Spedizione stimata: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

Laminin beta 1 Monoclonal antibody specifically detects Laminin beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigene Laminin beta 1
Applicazioni Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Monoclonal
Clone CL2970
Coniugato Unconjugated
Diluizione Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulazione PBS (pH 7.2), 40% Glycerol
N. accesso geni P07942
Alias gene CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015
Specie ospite Mouse
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Metodo di purificazione Protein A purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Primario o secondario Primary
ID gene (immissione) 3912
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG1
Linea di prodotti Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.