missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LLPH Antibody, Novus Biologicals™

LLPH Antibody, Novus Biologicals™

Codice prodotto. 18107619 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
25 μL
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18107619 100 μL 100µL
18624327 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18107619 Fornitore Novus Biologicals N. del fornitore NBP254933

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

LLPH Polyclonal specifically detects LLPH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifica

Antigene LLPH
Applicazioni Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulazione PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias gene C12orf31, Chromosome 12 Open Reading Frame 31, CPERP-G, HLLP, Human LAPS18-Like Protein, LLP Homolog, Long-Term Synaptic Facilitation, LLP Homolog, Long-Term Synaptic Facilitation (Aplysia), Protein LAPS18-Like, Protein LLP Homolog
Simboli geni LLPH
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG
Metodo di purificazione Affinity Purified
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 84298
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.