missing translation for 'onlineSavingsMsg'
Learn More

MAPK12 Recombinant Protein, Abnova

Marca:  Abnova H00006300-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160522

  • 458.00€ / 25µg


Spedizione stimata
30-11-2020
Aggiungi al carrello

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH15741.1
Solution
6300
MAPK12 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MAPK12
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Kinase Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
66
8
Glutathione Sepharose 4 Fast Flow
25 ug
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3
MAPK12
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti