missing translation for 'onlineSavingsMsg'
Learn More

FBXW4, Mouse, Polyclonal Antibody, Abnova™

Codice prodotto. 16175225
Cambia vista
Click to view available options
Quantità:
50 μL
Dimensione della confezione:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
16175225 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16175225 Fornitore Abnova N. del fornitore H00006468A01.50uL

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Mouse polyclonal antibody raised against a partial recombinant FBXW4.

This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq

Sequence: SYLDMRALGRLAQVCRWLRRFTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL

Specifica

Antigene FBXW4
Applicazioni ELISA, Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Descrizione Mouse polyclonal antibody raised against a partial recombinant FBXW4.
Formulazione 50% glycerol
Gene FBXW4
N. accesso geni NM_022039
Alias gene DAC/FBW4/FBWD4/SHFM3/SHSF3
Simboli geni FBXW4
Specie ospite Mouse
Immunogeno FBXW4 (NP_071322, 41 a.a. to 140 a.a) partial recombinant protein with GST tag.
Quantità 50 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 6468
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Forma Antisera
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.