missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30511213

MRG15 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Codice prodotto. 30511213 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità
30511213 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 30511213 Fornitore Novus Biologicals N. del fornitore NBP338377AF700

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

MRG15 Polyclonal antibody specifically detects MRG15 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigene MRG15
Applicazioni ELISA, Western Blot
Classificazione Polyclonal
Coniugato Alexa Fluor 700
Formulazione 50mM Sodium Borate
Alias gene Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15
Specie ospite Rabbit
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MRG15 (NP_006782.1).,, Sequence:, MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
Metodo di purificazione Affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca DNA replication Transcription Translation and Splicing
Primario o secondario Primary
ID gene (immissione) 10933
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.