missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
MYO1G Polyclonal specifically detects MYO1G in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
Specifica
| Antigene | MYO1G |
| Applicazioni | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Diluizione | Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias gene | HA2, myosin IG, myosin-Ig |
| Simboli geni | MYO1G |
| Specie ospite | Rabbit |
| Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?