missing translation for 'onlineSavingsMsg'
Learn More

MYO1G Antibody, Novus Biologicals™

Codice prodotto. 18452571 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18452571 25 μL 25µL
18095817 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18452571 Fornitore Novus Biologicals N. del fornitore NBP19370425ul

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody

MYO1G Polyclonal specifically detects MYO1G in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene MYO1G
Applicazioni Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias gene HA2, myosin IG, myosin-Ig
Simboli geni MYO1G
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 64005
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.