missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Odf1 Antibody - Azide and BSA Free, Novus Biologicals™

Odf1 Antibody - Azide and BSA Free, Novus Biologicals™

Codice prodotto. 18606580 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantità Unit Size
18606580 0.1 mL 0.10mL
18659650 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18606580 Supplier Novus Biologicals Supplier No. NBP2936010.1ml
 Articolo soggetto a restrizioni
Spedizione stimata: 03-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Odf1 Polyclonal specifically detects Odf1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigene Odf1
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS (pH 7.3), 50% glycerol
Alias gene cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF
Specie ospite Rabbit
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Metodo di purificazione Affinity purified
Quantità 0.1 mL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 4956
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.