missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PBX1 (Human) Recombinant Protein
Human PBX1 partial ORF (NP_002576.1, 311 a.a. - 403 a.a.) recombinant protein with GST tag at N-terminal.
Marca: Abnova™ H00005087-Q02.10ug
Dettagli aggiuntivi : Peso : 0.02000kg
Descrizione
- Sequence: VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG
Specifica
| NP_002576.1 | |
| pre-B-cell leukemia homeobox 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PBX1 | |
| GST |
| 5087 | |
| Wheat germ expression system | |
| 10 μg | |
| DKFZp686B09108, MGC126627 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |