missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PBX1 (Human) Recombinant Protein

Human PBX1 partial ORF (NP_002576.1, 311 a.a. - 403 a.a.) recombinant protein with GST tag at N-terminal.

Marca:  Abnova™ H00005087-Q02.10ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16014505

  • 320.54€ / 10µg


Spedizione stimata
03-06-2021
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG
Specifica

Specifica

NP_002576.1
pre-B-cell leukemia homeobox 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PBX1
GST
5087
Wheat germ expression system
10 μg
DKFZp686B09108, MGC126627
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documenti