missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

Codice prodotto. 18603770 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18603770 0.1 mL 0.10mL
18608421 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18603770 Fornitore Novus Biologicals N. del fornitore NBP2931550.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Visualizzare prodotti alternativi

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PCDHA10 Polyclonal antibody specifically detects PCDHA10 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigene PCDHA10
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS (pH 7.3), 50% glycerol
Alias gene CNR8, CNRN8, CNRS8, CRNR8, KIAA0345-like 4, ortholog to mouse CNR8, PCDH-alpha-10, PCDH-ALPHA10, protocadherin alpha 10, protocadherin alpha-10
Specie ospite Rabbit
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1). PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL
Metodo di purificazione Affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 56139
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.