missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCSK4 (Human) Recombinant Protein

Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00054760-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160733

  • 302.00€ / 10µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Specifica

Specifica

AAH36354
proprotein convertase subtilisin/kexin type 4
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCSK4
GST
54760
Wheat germ expression system
10 μg
DKFZp434B217, MGC34749, PC4, SPC5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti