missing translation for 'onlineSavingsMsg'
Learn More

PHB Recombinant Protein, Abnova

Human PHB full-length ORF recombinant protein with GST-tag at N-terminal

Marca:  Abnova H00005245-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16159021

  • 458.00€ / 25µg


Spedizione stimata
01-12-2020
Aggiungi al carrello

Descrizione

Descrizione

Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed. It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor. Mutations in PHB have been linked to sporadic breast cancer. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA

  • Theoretical MW (kDa): 55.66
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH13401
Solution
5245
PHB (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PHB
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
55.7
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
PHB1
PHB
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti