missing translation for 'onlineSavingsMsg'
Learn More

Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody, Novus Biologicals™

Codice prodotto. 18438190 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18438190 25 μL 25µL
18280917 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18438190 Fornitore Novus Biologicals N. del fornitore NBP18595525ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit Polyclonal Antibody has been used in 2 publications

Pyruvate Dehydrogenase Kinase 1/PDK1 Polyclonal specifically detects Pyruvate Dehydrogenase Kinase 1/PDK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene Pyruvate Dehydrogenase Kinase 1/PDK1
Applicazioni Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N. accesso geni Q15118
Alias gene EC 2.7.11, EC 2.7.11.2, mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1, PDH kinase 1, PDK1, PDK-1, PKB kinase, Pyruvate dehydrogenase kinase isoform 1, pyruvate dehydrogenase kinase, isoenzyme 1, pyruvate dehydrogenase kinase, isozyme 1, Pyruvate dehydrogenase lipoamide kinase isozyme 1, mitochondrial
Simboli geni PDK1
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
Peso molecolare dell'antigene 49 kDa
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Disciplina di ricerca Autophagy, Cancer, Cytoskeleton Markers, Hypoxia, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 5163
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.