missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB8A (Human) Recombinant Protein

Human RAB8A full-length ORF ( AAH02977, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00004218-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161175

  • 458.00€ / 25µg


Spedizione stimata
27-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Specifica

Specifica

AAH02977
RAB8A, member RAS oncogene family
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAB8A
GST
4218
Wheat germ expression system
25 μg
MEL, RAB8
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documenti