missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16164110

NLE1, Rabbit, Polyclonal Antibody, Abnova™

Codice prodotto. 16164110
Cambia vista
Click to view available options
Quantità:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantità unitSize
16164110 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16164110 Supplier Abnova Supplier No. PAB21176.100uL

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

Rabbit polyclonal antibody raised against recombinant NLE1.

Sequence: TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL

Specifications

Antigene NLE1
Applicazioni Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Descrizione Rabbit polyclonal antibody raised against recombinant NLE1.
Diluizione Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Formulazione In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene NLE1
Alias gene FLJ10458/Nle
Simboli geni NLE1
Specie ospite Rabbit
Immunogeno Recombinant protein corresponding to amino acids of human NLE1.
Metodo di purificazione Antigen affinity purification
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 54475
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Forma Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.