missing translation for 'onlineSavingsMsg'
Learn More

SLC9A5 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Codice prodotto. 16186200
Cambia vista
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
16186200 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16186200 Fornitore Abnova N. del fornitore PAB23781.100uL

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Rabbit polyclonal antibody raised against recombinant SLC9A5.

Sequence: GHVLSSTGLTLPSMPSRNSVAETSVTNLLRESGSGACLDLQVIDTVRSGRDREDAVMHHLLCGGLYKPRRRYKASCSRHFISEDAQERQDKEVFQQNMKRRL

Specifica

Antigene SLC9A5
Applicazioni Immunohistochemistry (PFA fixed)
Classificazione Polyclonal
Coniugato Unconjugated
Descrizione Rabbit polyclonal antibody raised against recombinant SLC9A5.
Diluizione Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
Formulazione In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene SLC9A5
Alias gene NHE5
Simboli geni SLC9A5
Specie ospite Rabbit
Immunogeno Recombinant protein corresponding to amino acids of human SLC9A5.
Metodo di purificazione Antigen affinity purification
Quantità 100 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 6553
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Forma Liquid
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.