missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12342-1mg

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15940119

Quantità Prezzo
1 1462.00€ / 1mg
3 1375.16€ / 1mg
Spedizione stimata
14-01-2021
Aggiungi al carrello


Descrizione

Descrizione

Specifica

Specifica

HSV HSV-2 gB Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HSV
His
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Protein is >90% pure as determined by SDS PAGE.
Research Use Only
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Videos
SDS
Documenti