missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Human OTOR Protein

enQuireBio™ Recombinant Human OTOR Protein

Codice prodotto. 15902019
Cambia vista
Click to view available options
Quantità:
1 mg
20 μg
5 μg
Dimensione della confezione:
1mg
20µg
5µg
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
15902019 5 μg 5µg
15992009 20 μg 20µg
15982009 1 mg 1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 15902019 Fornitore enQuireBio™ N. del fornitore QP129385ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A cDNA sequence encoding the OTOR was constructed and used to recombinantly synthesize the protein.

Specifica

ID gene (immissione) 56914
Nome OTOR Protein
Quantità 5 μg
Status giuridico Research Use Only
Concentrazione di endotossine Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Simbolo del gene OTOR
Product Type Recombinant Protein
Cross-reattività Human
Specie E. coli
Tag proteine Untagged
Sequenza VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Tampone The OTOR protein was lyophilized from a concentrated (1 mg/ml) solution containing 20mM PBS pH 7.4 and 130mM NaCl.
Purity or Quality Grade Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.