missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12946-EC-5ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15942039

Quantità Prezzo
1 111.00€ / 5µg
10 103.80€ / 5µg
Spedizione stimata
06-01-2021
Aggiungi al carrello


Descrizione

Descrizione

Specifica

Specifica

1029
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
CDKN2A
Human
Untagged
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
p16-INK4a Protein
5 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Videos
SDS
Documenti