missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PROC Protein

A cDNA sequence encoding the PROC was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13151-100ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15952659

  • 1465.00€ / 100µg

Spedizione stimata: 27-01-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

5624
Greater than 80.0% as determined by SDS-PAGE.
Research Use Only
PROC
Human
His
PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
PROC Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHHThe first 32 amino acids are predicted as signal peptide
Videos
SDS
Documenti
Certificati
Offerte speciali

Offerte speciali