missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL17E Protein
A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.
137.00€ - 4090.00€
Specifica
ID gene (immissione) | 140806 |
---|---|
Nome | IL17E Protein |
Status giuridico | Research Use Only |
Concentrazione di endotossine | < 1.0 EU per ug protein as determined by the LAL method. |
Simbolo del gene | Il25 |
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
---|---|---|---|---|---|---|---|---|---|
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
15964978
|
enQuireBio™
QP10725-5UG |
5 μg |
137.00€
5µg |
Spedizione stimata: 14-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
15954978
|
enQuireBio™
QP10725-25UG |
25 μg |
212.00€
25µg |
Spedizione stimata: 14-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
15944978
|
enQuireBio™
QP10725-1MG |
1 mg |
4090.00€
1mg |
Spedizione stimata: 14-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Specifica
140806 | |
Research Use Only | |
Il25 | |
Recombinant Protein | |
E. coli | |
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
IL17E Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
Mouse | |
Untagged | |
IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |