missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP11985-100ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15939008

Quantità Prezzo
1 188.00€ / 100µg
6 176.42€ / 100µg
Spedizione stimata
11-01-2021
Aggiungi al carrello


Descrizione

Descrizione

Specifica

Specifica

Gliadin Gamma Wheat Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
His
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.
Protein is >90% pure.
Research Use Only
Recombinant Protein
E. coli
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Videos
SDS
Documenti