missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit GHBP Protein

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10642-20ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15954498

  • 181.00€ / 20µg

Spedizione stimata: 31-01-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

GHBP Protein
20 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Greater than 98.0% as determined bySDS-PAGE.
Research Use Only
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Rabbit
Untagged
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Videos
SDS
Documenti
Certificati
Offerte speciali

Offerte speciali