missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit IL 8 Protein

A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12400-1mg

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15940299

  • 4385.00€ / 1mg


Spedizione stimata
08-01-2021
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

100009129
Greater than 90% as determined by SDS-PAGE.
Research Use Only
CXCL8
Rabbit
His
The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
IL 8 Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES
Videos
SDS
Documenti