missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat RAP Protein

A cDNA sequence encoding the RAP was constructed and used to recombinantly synthesize the protein.

120.00€ - 3730.00€

Specifica

Nome RAP Protein
Purezza Greater than 95.0% as determined by SDS-PAGE.
Status giuridico Research Use Only
Concentrazione di endotossine Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Visualizza altre specifiche

Prodotti 3
Codice del prodotto Marca Quantità Prezzo Quantità e disponibilità  
Codice del prodotto Marca Quantità Prezzo Quantità e disponibilità  
15963019
Vedere i documenti Dettagli della promozione
enQuireBio™
QP13264-5UG
5 μg
120.00€
5µg
Visualizzare prodotti alternativi
Risparmia fino a 
»
Spedizione stimata: 24-03-2023
per visualizzare lo stock disponibile
Aggiungi al carrello
 
15953019
Vedere i documenti Dettagli della promozione
enQuireBio™
QP13264-20UG
20 μg
181.00€
20µg
Visualizzare prodotti alternativi
Risparmia fino a 
»
Spedizione stimata: 24-03-2023
per visualizzare lo stock disponibile
Aggiungi al carrello
 
15943019
Vedere i documenti Dettagli della promozione
enQuireBio™
QP13264-1MG
1 mg
3730.00€
1mg
Visualizzare prodotti alternativi
Risparmia fino a 
»
Spedizione stimata: 24-03-2023
per visualizzare lo stock disponibile
Aggiungi al carrello
 
Descrizione

Descrizione

Specifica

Specifica

RAP Protein
Research Use Only
Recombinant Protein
E. coli
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Greater than 95.0% as determined by SDS-PAGE.
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
SDS
Product Certifications