missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13965-100ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15955259

  • 205.00€ / 100µg

Spedizione stimata: 07-02-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

West Nile Virus WNV Pre-M Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
West Nile Virus
His
20mM phosphate buffer pH 7.5.
Protein is >95% pure as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali