missing translation for 'onlineSavingsMsg'
Learn More

RHOJ Recombinant Protein, Abnova

Marca:  Abnova H00057381-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162643

  • 458.00€ / 25µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH62575
Solution
57381
RHOJ (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RHOJ
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
49.28
8
Glutathione Sepharose 4 Fast Flow
25 ug
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII
ARHJ|FLJ14445|MGC34777|RASL7B|TC10B|TCL
RHOJ
Wheat Germ (in vitro)
GST
Videos
Documenti