missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ S100A8 Recombinant Protein
Human S100A8 full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00006279-P01.10ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.
- Theoretical MW (kDa): 35.97
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
| AAH05928.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 35.97 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE | |
| 60B8AG/CAGA/CFAG/CGLA/CP-10/L1Ag/MA387/MIF/MRP8/NIF/P8 | |
| S100A8 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 6279 | |
| S100A8 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| S100A8 | |
| Human | |
| Recombinant | |
| Solution |
Sicurezza e movimentazione
Identificativo prodotto
Avvertenza
Categoria di pericolo
Indicazioni di pericolo
Consigli di prudenza
Informazioni supplementari
- S100A8 (Human) Recombinant Protein (P01)
Avvertenza
- Attenzione
Categoria di pericolo
- Tossicità acuta Categoria 4
- Lesione oculare grave/irritazione oculare Categoria 2
- Corrosione/irritazione della pelle Categoria 2
Indicazioni di pericolo
- H302-Nocivo se ingerito.
- H315-Provoca irritazione cutanea.
- H319-Provoca grave irritazione oculare.
Consigli di prudenza
- P102-Tenere fuori dalla portata dei bambini.
- P103-Leggere l'etichetta prima dell'uso.
- P233-Tenere il recipiente ben chiuso.
- P264-Lavare accuratamente dopo l'uso.
- P270-Non mangiare, né bere, né fumare durante l'uso.
- P280-Indossare guanti/indumenti protettivi/Proteggere gli occhi/il viso.
- P301+P310-IN CASO DI INGESTIONE: contattare immediatamente un CENTRO ANTIVELENI/un medico/
- P305+P351+P338-IN CASO DI CONTATTO CON GLI OCCHI: sciacquare accuratamente per parecchi minuti. Togliere le eventuali lenti a contatto se è agevole farlo. Continuare a sciacquare.
- P404-Conservare in un recipiente chiuso.
- P501b-Smaltire il prodotto/recipiente in conformità con le disposizioni locali/regionali/nazionali/internazionali.
Informazioni supplementari
- MIXTURE LIST-Contiene: tris-HCl, reduced glutathione