missing translation for 'onlineSavingsMsg'
Learn More

SLC25A11 Recombinant Protein (P02), Abnova

Marca:  Abnova H00008402-P02.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162422

  • 458.00€ / 25µg


Spedizione stimata
18-11-2020
Aggiungi al carrello

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica

Specifica

AAH06508
Solution
8402
SLC25A11 (Human) Recombinant Protein (P02)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SLC25A11
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
60.3
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
OGC|SLC20A4
SLC25A11
Wheat Germ (in vitro)
GST
Videos
Documenti