missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC38A3 Antibody - Azide and BSA Free, R&D Systems™

SLC38A3 Antibody - Azide and BSA Free, R&D Systems™

Codice prodotto. 18620691 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18620691 0.02 mL 0.02mL
18686580 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18620691 Fornitore Novus Biologicals N. del fornitore NBP2931430.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Alternative Produkte anzeigen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC38A3 Polyclonal antibody specifically detects SLC38A3 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigene SLC38A3
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 1:500-1:2000
Formulazione PBS (pH 7.3), 50% glycerol
Alias gene G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Specie ospite Rabbit
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1). MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK
Metodo di purificazione Affinity purified
Quantità 0.02 mL
Status giuridico RUO
Disciplina di ricerca Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
Primario o secondario Primary
ID gene (immissione) 10991
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.