missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC8A2 Antibody, Novus Biologicals™

SLC8A2 Antibody, Novus Biologicals™

Codice prodotto. 18664878 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18664878 0.1 mL 0.10mL
18613839 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18664878 Fornitore Novus Biologicals N. del fornitore NBP248980

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

SLC8A2 Polyclonal antibody specifically detects SLC8A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigene SLC8A2
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene KIAA1087, Na(+)/Ca(2+)-exchange protein 2, Na+/Ca2+-exchanging protein Nac2, NCX2, sodium/calcium exchanger 2, sodium-calcium exchanger 2, solute carrier family 8 (sodium/calcium exchanger), member 2, solute carrier family 8 (sodium-calcium exchanger), member 2, solute carrier family 8 member 2
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: PANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDKAA
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 6543
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.